{"product_id":"proteintech-83093-2-rr","title":"Proteintech, 83093-2-RR, PCP4L1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PCP4L1 (83093-2-RR) by Proteintech is a Recombinant antibody targeting PCP4L1 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83093-2-RR targets PCP4L1 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: Caco-2 cells\nPositive FC (Intra) detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCP4L1 (Purkinje cell protein 4-like 1) is a small neuronal IQ motif protein closely related to the calmodulin-binding protein Pcp4\/PEP-19 (PMID: 22458599).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag31230 Product name: Recombinant human PCP4L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-68 aa of BC028905 Sequence: MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS Predict reactive species\nFull Name: Purkinje cell protein 4 like 1\nCalculated Molecular Weight: 68 aa, 7 kDa\nGenBank Accession Number: BC028905\nGene Symbol: PCP4L1\nGene ID (NCBI): 654790\nRRID: AB_3670807\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: A6NKN8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888863858857,"sku":"83093-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83093-2-rr","provider":"Iright","version":"1.0","type":"link"}