{"product_id":"proteintech-83107-1-rr","title":"Proteintech, 83107-1-RR, DTL Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DTL (83107-1-RR) by Proteintech is a Recombinant antibody targeting DTL in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83107-1-RR targets DTL in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDT2, also named as L2DTL or RAMP, is one of the substrate receptors of the Cullin Ring Ubiquitin Ligase 4 that targets for ubiquitin mediated degradation a number of substrates, such as CDT1, p21 and CHK1, involved in the regulation of cell cycle and survival. CDT2 overexpression was reported in breast (PMID: 18542055), gastric (PMID: 19672268) and ovarian carcinomas (PMID: 23995842) and rhabdomyosarcomas (PMID: 19235922) and associated with the aggressiveness of hepatocellular carcinomas (PMID: 17106265).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33391 Product name: Recombinant human DTL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC033540 Sequence: MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGII Predict reactive species\nFull Name: denticleless homolog (Drosophila)\nCalculated Molecular Weight: 730 aa, 79 kDa\nGenBank Accession Number: BC033540\nGene Symbol: DTL\nGene ID (NCBI): 51514\nRRID: AB_3670819\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NZJ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888851177641,"sku":"83107-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83107-1-rr","provider":"Iright","version":"1.0","type":"link"}