{"product_id":"proteintech-83136-3-rr","title":"Proteintech, 83136-3-RR, TLR3\/CD283 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TLR3\/CD283 (83136-3-RR) by Proteintech is a Recombinant antibody targeting TLR3\/CD283 in WB, IHC, ELISA applications with reactivity to human samples\n83136-3-RR targets TLR3\/CD283 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, human placenta tissue\nPositive IHC detected in: human ovarian  cancer, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:14000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1\/TRIF, leading to the induction of type I IFN, cytokine\/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679). Western detected full-length (∼120 kD) and cleaved (∼70 kDa) TLR3 (PMID: 28717003).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34044 Product name: Recombinant human TLR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 725-904 aa of BC094737 Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH Predict reactive species\nFull Name: toll-like receptor 3\nCalculated Molecular Weight: 904 aa, 104 kDa\nObserved Molecular Weight: 120 kDa, 68 kDa\nGenBank Accession Number: BC094737\nGene Symbol: TLR3\nGene ID (NCBI): 7098\nRRID: AB_3670837\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O15455\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888350449833,"sku":"83136-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83136-3-rr","provider":"Iright","version":"1.0","type":"link"}