{"product_id":"proteintech-83172-2-rr","title":"Proteintech, 83172-2-RR, USP8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe USP8 (83172-2-RR) by Proteintech is a Recombinant antibody targeting USP8 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83172-2-RR targets USP8 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, K-562 cells,  A549 cells,  HepG2 cells,  HEK-293 cells,  HeLa cells,  MCF-7 cells\nPositive IF\/ICC detected in: U2OS cells, HeLa cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP8 is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag27143 Product name: Recombinant human USP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-253 aa of BC110590 Sequence: SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV Predict reactive species\nFull Name: ubiquitin specific peptidase 8\nCalculated Molecular Weight: 1118 aa, 128 kDa\nObserved Molecular Weight: 128 kDa\nGenBank Accession Number: BC110590\nGene Symbol: USP8\nGene ID (NCBI): 9101\nRRID: AB_3670867\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P40818\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888522776745,"sku":"83172-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83172-2-rr","provider":"Iright","version":"1.0","type":"link"}