{"product_id":"proteintech-83183-4-rr","title":"Proteintech, 83183-4-RR, KLF9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KLF9 (83183-4-RR) by Proteintech is a Recombinant antibody targeting KLF9 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83183-4-RR targets KLF9 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  HepG2 cells,  A549 cells,  U2OS cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKrüppel-like factor 9 (KLF9) was a member of SP\/KLF family of DNA-binding transcriptional regulators featured by a highly homologous C-terminal three C2H2-type zinc finger DNA-binding domains. KLF9 has been previously reported to be downregulated in various types of human malignancy and serves as a tumour suppressor at tumour onset and development, affecting cell proliferation, apoptosis, metastasis and tumorigenicity (PMID: 32855660).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34411 Product name: Recombinant human KLF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC074880 Sequence: MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGC Predict reactive species\nFull Name: Kruppel-like factor 9\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27-35 kDa\nGenBank Accession Number: BC074880\nGene Symbol: KLF9\nGene ID (NCBI): 687\nRRID: AB_3670873\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13886\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888432697513,"sku":"83183-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83183-4-rr","provider":"Iright","version":"1.0","type":"link"}