{"product_id":"proteintech-83194-5-rr","title":"Proteintech, 83194-5-RR, HIRA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HIRA (83194-5-RR) by Proteintech is a Recombinant antibody targeting HIRA in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83194-5-RR targets HIRA in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHIRA protein is encoded by a gene within a region of human chromosome 22q11.2 deleted in most patients with the DiGeorge syndrome, a developmental disorder, and was named for its amino acid sequence homology to two S. cerevisiae proteins, Hir1p and Hir2p. HIRA is critical in a specific chromatin assembly pathway that takes place independently of DNA synthesis (PMID: 12049744). HIRA complex associates with various proteins, such as transcription factors, RNA pol II, Prohibitin (PHB), and replication protein A (RPA) suggests that the targeting of the complex at specific locations may exploit additional structural properties and mechanisms (PMID: 30082790).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34439 Product name: Recombinant human HIRA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 850-1017 aa of NM_003325 Sequence: SLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK Predict reactive species\nFull Name: HIR histone cell cycle regulation defective homolog A (S. cerevisiae)\nCalculated Molecular Weight: 112 kDa\nGenBank Accession Number: NM_003325\nGene Symbol: HIRA\nGene ID (NCBI): 7290\nRRID: AB_3670884\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P54198\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888859041961,"sku":"83194-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83194-5-rr","provider":"Iright","version":"1.0","type":"link"}