{"product_id":"proteintech-83214-5-rr","title":"Proteintech, 83214-5-RR, PDGF-BB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PDGF-BB (83214-5-RR) by Proteintech is a Recombinant antibody targeting PDGF-BB in WB, ELISA applications with reactivity to human, mouse, rat samples\n83214-5-RR targets PDGF-BB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, A549 cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPlatelet-derived growth factor (PDGF) belongs to the family of growth factors consisting of four secreted extracellular ligands including PDGF-A, -B, -C and -D. These isoforms, PDGF-AA, PDGF-AB, PDGF-BB, PDGF-CC and PDGF-DD, act via two receptor tyrosine kinases, PDGF receptors alpha and beta. PDGF isoforms stimulate growth, survival and motility of mesenchymal cells and certain other cell type. They have important functions during embryonal development and in the control of tissue homeostasis in the adult. PDGF-BB is one of the most recently studied isoforms and it plays an important role in skeletal development. PDGF-BB stimulates cell-mediated collagen gel contraction. PDGF-BB modulates endothelial proliferation and angiogenesis in vitro via PDGF beta-receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25986 Product name: Recombinant human PDGFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC029822 Sequence: MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIA Predict reactive species\nFull Name: platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)\nCalculated Molecular Weight: 241 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC029822\nGene Symbol: PDGFB\nGene ID (NCBI): 5155\nRRID: AB_3670899\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P01127-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888654962857,"sku":"83214-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83214-5-rr","provider":"Iright","version":"1.0","type":"link"}