{"product_id":"proteintech-83217-5-rr","title":"Proteintech, 83217-5-RR, NUDCD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NUDCD2 (83217-5-RR) by Proteintech is a Recombinant antibody targeting NUDCD2 in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n83217-5-RR targets NUDCD2 in WB, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  HepG2 cells,  U-251 cells\nPositive IP detected in: HepG2 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUDCD2, also known as NudCL2, is an HSP90 cochaperone that regulates sister chromatid cohesion during mitosis. NUDCD2 also plays a role in ciliogenesis(PMID: 30368549, 34480124). NUDCD2 regulates the LIS1\/dynein pathway by stabilizing LIS1 with Hsp90 chaperone(PMID: 20133715).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15579 Product name: Recombinant human NUDCD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC017934 Sequence: MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK Predict reactive species\nFull Name: NudC domain containing 2\nCalculated Molecular Weight: 157 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC017934\nGene Symbol: NUDCD2\nGene ID (NCBI): 134492\nRRID: AB_3670903\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8WVJ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888358445225,"sku":"83217-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83217-5-rr","provider":"Iright","version":"1.0","type":"link"}