{"product_id":"proteintech-83239-5-rr","title":"Proteintech, 83239-5-RR, SLC16A11 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC16A11 (83239-5-RR) by Proteintech is a Recombinant antibody targeting SLC16A11 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83239-5-RR targets SLC16A11 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  mouse brain tissue,  mouse stomach tissue\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24920 Product name: Recombinant human SLC16A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 397-471 aa of BC093860 Sequence: FLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC Predict reactive species\nFull Name: solute carrier family 16, member 11 (monocarboxylic acid transporter 11)\nCalculated Molecular Weight: 471 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC093860\nGene Symbol: SLC16A11\nGene ID (NCBI): 162515\nRRID: AB_3670915\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8NCK7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888516878505,"sku":"83239-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83239-5-rr","provider":"Iright","version":"1.0","type":"link"}