{"product_id":"proteintech-83266-5-rr","title":"Proteintech, 83266-5-RR, BUB3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BUB3 (83266-5-RR) by Proteintech is a Recombinant antibody targeting BUB3 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples\n83266-5-RR targets BUB3 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  MCF-7 cells,  Jurkat cells,  C6 cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25608 Product name: Recombinant human BUB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 205-328 aa of BC005138 Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT Predict reactive species\nFull Name: budding uninhibited by benzimidazoles 3 homolog (yeast)\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 37-40 kDa\nGenBank Accession Number: BC005138\nGene Symbol: BUB3\nGene ID (NCBI): 9184\nRRID: AB_3670939\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O43684\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888396980393,"sku":"83266-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83266-5-rr","provider":"Iright","version":"1.0","type":"link"}