{"product_id":"proteintech-83312-1-rr","title":"Proteintech, 83312-1-RR, COPS8 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe COPS8 (83312-1-RR) by Proteintech is a Recombinant antibody targeting COPS8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n83312-1-RR targets COPS8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, HepG2 cells,  T-47D cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:125-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOPS8 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0143 Product name: Recombinant human COPS8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-194 aa of BC003090 Sequence: KKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNE Predict reactive species\nFull Name: COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC003090\nGene Symbol: COPS8\nGene ID (NCBI): 10920\nRRID: AB_3670979\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99627\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888353169577,"sku":"83312-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83312-1-rr","provider":"Iright","version":"1.0","type":"link"}