{"product_id":"proteintech-83322-3-rr","title":"Proteintech, 83322-3-RR, AQP6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe AQP6 (83322-3-RR) by Proteintech is a Recombinant antibody targeting AQP6 in WB, ELISA applications with reactivity to human samples\n83322-3-RR targets AQP6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HEK-293 cells,  MCF-7 cells,  U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAQP6 (Aquaporin-6) has recently been identified as an intracellular vesicle water channel with anion permeability that is activated by low pH or HgCl2 (PMID: 12034750). It could be involved in physiological mechanisms of fluid movement, acid-base regulation, and\/or anion transport. The calculated MW of AQP6 is 29 kDa, but the actual observed MW is around 35 kDa, which represents glycosylated AQP6 monomer forms (PMID: 19811639).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26845 Product name: Recombinant human AQP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-282 aa of NM_001652 Sequence: MLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV Predict reactive species\nFull Name: aquaporin 6, kidney specific\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: NM_001652\nGene Symbol: AQP6\nGene ID (NCBI): 363\nRRID: AB_3670988\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q13520\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888589230249,"sku":"83322-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83322-3-rr","provider":"Iright","version":"1.0","type":"link"}