{"product_id":"proteintech-83364-4-rr","title":"Proteintech, 83364-4-RR, PCARE Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PCARE (83364-4-RR) by Proteintech is a Recombinant antibody targeting PCARE in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n83364-4-RR targets PCARE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse retina tissue, mouse eye tissue\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC2orf71\/PCARE (photoreceptor cilium actin regulator) is a retina-specific protein consisting of 1289 amino acids with a predicted molecular weight of 140 kDa. PCARE is predicted to be myristoylated and palmitoylated at its N terminus and plays an important role in delivering actin-associated components to the base of the photoreceptor OSs to regulate the initial development of OS disks (PMID: 32312818, 35253837).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34774 Product name: Recombinant human PCARE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-150 aa of NM_001029883 Sequence: LVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEEQPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSSQLNKSQSHMAKDIPFKTQGSHGSQGADFSGDESEESSTQDTSKWKRTAK Predict reactive species\nFull Name: chromosome 2 open reading frame 71\nCalculated Molecular Weight: 140 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_001029883\nGene Symbol: PCARE\nGene ID (NCBI): 388939\nRRID: AB_3671018\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: A6NGG8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888654504105,"sku":"83364-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83364-4-rr","provider":"Iright","version":"1.0","type":"link"}