{"product_id":"proteintech-83378-1-rr","title":"Proteintech, 83378-1-RR, XRN2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe XRN2 (83378-1-RR) by Proteintech is a Recombinant antibody targeting XRN2 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83378-1-RR targets XRN2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Jurkat cells,  HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXRN2 is one exonuclease that degrades the Pol II associated product of poly(A) site cleavage, which is crucial for Pol II termination. During transcription termination, XRN2 cleavages at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag30781 Product name: Recombinant human XRN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 400-580 aa of BC006417 Sequence: MLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN Predict reactive species\nFull Name: 5'-3' exoribonuclease 2\nCalculated Molecular Weight: 104 kDa\nObserved Molecular Weight: 109 kDa\nGenBank Accession Number: BC006417\nGene Symbol: XRN2\nGene ID (NCBI): 22803\nRRID: AB_3671032\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9H0D6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888523694249,"sku":"83378-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83378-1-rr","provider":"Iright","version":"1.0","type":"link"}