{"product_id":"proteintech-83403-1-rr","title":"Proteintech, 83403-1-RR, SREBF2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SREBF2 (83403-1-RR) by Proteintech is a Recombinant antibody targeting SREBF2 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83403-1-RR targets SREBF2 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH  domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is  required for lipid homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28205 Product name: Recombinant human SREBF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 375-479 aa of BC056158 Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR Predict reactive species\nFull Name: sterol regulatory element binding transcription factor 2\nCalculated Molecular Weight: 124 kDa\nGenBank Accession Number: BC056158\nGene Symbol: SREBF2\nGene ID (NCBI): 6721\nRRID: AB_3671053\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q12772\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888866447529,"sku":"83403-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83403-1-rr","provider":"Iright","version":"1.0","type":"link"}