{"product_id":"proteintech-83414-5-rr","title":"Proteintech, 83414-5-RR, TBX20 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TBX20 (83414-5-RR) by Proteintech is a Recombinant antibody targeting TBX20 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n83414-5-RR targets TBX20 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: H9C2 cells, mouse heart tissue,  rat heart tisue\nPositive FC (Intra) detected in: k562\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTbx20 is a transcription factor that is essential for proper heart development in a growing fetus. Any mutations in this gene can result in various forms of congenital heart disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18501 Product name: Recombinant human TBX20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC120946 Sequence: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTE Predict reactive species\nFull Name: T-box 20\nCalculated Molecular Weight: 297 aa, 33 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC120946\nGene Symbol: TBX20\nGene ID (NCBI): 57057\nRRID: AB_3671063\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UMR3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888519565481,"sku":"83414-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83414-5-rr","provider":"Iright","version":"1.0","type":"link"}