{"product_id":"proteintech-83421-1-rr","title":"Proteintech, 83421-1-RR, PTDSS1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PTDSS1 (83421-1-RR) by Proteintech is a Recombinant antibody targeting PTDSS1 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83421-1-RR targets PTDSS1 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: Hela cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhosphatidylserine Synthase-1 (PTDSS1 or PSS1) is one of two enzymes involved in the production of phosphatidylserine (PS), which is a quantitatively minor, but physiologically important phospholipid in mammalian cells (PMID: 24241535). Mice lacking either Ptdss1 or Ptdss2 are viable, phenotypically normal and fertile, indicating that, in mice, PSS1 and PSS2 can compensate for each other (PMID: 18343815).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14170 Product name: Recombinant human PTDSS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-473 aa of BC002376 Sequence: TTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK Predict reactive species\nFull Name: phosphatidylserine synthase 1\nCalculated Molecular Weight: 473 aa, 56 kDa\nGenBank Accession Number: BC002376\nGene Symbol: PTDSS1\nGene ID (NCBI): 9791\nRRID: AB_3671070\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P48651\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888864710825,"sku":"83421-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83421-1-rr","provider":"Iright","version":"1.0","type":"link"}