{"product_id":"proteintech-83470-3-rr","title":"Proteintech, 83470-3-RR, RABL2B Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RABL2B (83470-3-RR) by Proteintech is a Recombinant antibody targeting RABL2B in WB, FC (Intra), ELISA applications with reactivity to human samples\n83470-3-RR targets RABL2B in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HepG2 cells\nPositive FC (Intra) detected in: A549 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab-like protein 2B (RABL2B) is a member of a poorly characterised clade of the RAS GTPase superfamily, which plays an essential role in male fertility, sperm intraflagellar transport and tail assembly (PMID: 28553998, PMID: 28138870). A preferential expression of RABL2B in human tissues and lymphoblastoid cell lines was detected which is most pronounced in brain and placenta (PMID: 20138207).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2189 Product name: Recombinant human RABL2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC024281 Sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS Predict reactive species\nFull Name: RAB, member of RAS oncogene family-like 2B\nCalculated Molecular Weight: 229 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC024281\nGene Symbol: RABL2B\nGene ID (NCBI): 11158\nRRID: AB_3671100\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UNT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888440692905,"sku":"83470-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83470-3-rr","provider":"Iright","version":"1.0","type":"link"}