{"product_id":"proteintech-83484-2-rr","title":"Proteintech, 83484-2-RR, STEAP3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe STEAP3 (83484-2-RR) by Proteintech is a Recombinant antibody targeting STEAP3 in WB, FC (Intra), ELISA applications with reactivity to human, rat samples\n83484-2-RR targets STEAP3 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  PC-12 cells,  C6 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTEAP3 (Six-Transmembrane Epithelial Antigen of Prostate 3) is also named as TSAP6, Dudulin-2 and pHyde, and belongs to the STEAP family. STEAP3 is a member of the STEAP family and is composed of a six-transmembrane domain at the COOH-terminal domain and a cytoplasmic N-terminal oxidoreductase domain, which is essential for iron and copper uptake (PMID:16227996). STEAP3 contains a functional p53-binding site in its promoter and can be upregulated following p53 activation to enhance cell death in myeloid leukemia cell line and breast cancer cells (PMID: 18617898). By interacting with Nix, a pro-apoptotic Bcl-2 family member, and Myt1 kinase, a negative regulator of the G2\/M transition, STEAP3 overexpression promotes apoptosis and inhibits G2\/M transition in cell cycle progression (PMID: 12606722, PMID: 10504341).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29528 Product name: Recombinant human STEAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-130 aa of BC042150 Sequence: NPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNA Predict reactive species\nFull Name: STEAP family member 3\nCalculated Molecular Weight: 488 aa, 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC042150\nGene Symbol: STEAP3\nGene ID (NCBI): 55240\nRRID: AB_3671112\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q658P3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888668201129,"sku":"83484-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83484-2-rr","provider":"Iright","version":"1.0","type":"link"}