{"product_id":"proteintech-83490-2-rr","title":"Proteintech, 83490-2-RR, NELF Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NELF (83490-2-RR) by Proteintech is a Recombinant antibody targeting NELF in WB, ELISA applications with reactivity to Human samples\n83490-2-RR targets NELF in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNSMF, also named as NELF (Nasal embryonic LHRH factor), couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. NELF plays a major role in promoter-proximal pausing, a widespread phenomenon during early transcription elongation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34902 Product name: Recombinant human NELF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-268 aa of BC016862 Sequence: KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL Predict reactive species\nFull Name: nasal embryonic LHRH factor\nCalculated Molecular Weight: 507 aa, 56 kDa\nObserved Molecular Weight: 54-60 kDa\nGenBank Accession Number: BC016862\nGene Symbol: NELF\nGene ID (NCBI): 26012\nRRID: AB_3671117\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6X4W1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888652603561,"sku":"83490-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83490-2-rr","provider":"Iright","version":"1.0","type":"link"}