{"product_id":"proteintech-83514-3-rr","title":"Proteintech, 83514-3-RR, Integrin beta 5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Integrin beta 5 (83514-3-RR) by Proteintech is a Recombinant antibody targeting Integrin beta 5 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n83514-3-RR targets Integrin beta 5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HT-29 cells,  NIH-H1299 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nITGB5, also known as Integrin beta-5. It is expected to be located in the plasma membrane and mitochondria, which is i ubiquitinated in placenta and gall bladder. ITGB5 is a member of integrins and was proved to be associated with pathological processes in several tumors (PMID: 34966851). It is reported that TGB5 is highly expressed in hepatocellular carcinoma (HCC), and miR-185 regulates the expression of β- catenin through the ITGB5-dependent manner and affects the proliferation and migration of HCC cells (PMID: 35223869). The molecular weight of ITGB5 is 88 kDa, and the glycosylation modification also exists.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29783 Product name: Recombinant human Integrin beta-5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-126 aa of BC006541 Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF Predict reactive species\nFull Name: integrin, beta 5\nCalculated Molecular Weight: 88 kDa\nObserved Molecular Weight: 88-100 kDa\nGenBank Accession Number: BC006541\nGene Symbol: Integrin beta 5\nGene ID (NCBI): 3693\nRRID: AB_3671139\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P18084\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888644837545,"sku":"83514-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83514-3-rr","provider":"Iright","version":"1.0","type":"link"}