{"product_id":"proteintech-83534-1-rr","title":"Proteintech, 83534-1-RR, GBP3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GBP3 (83534-1-RR) by Proteintech is a Recombinant antibody targeting GBP3 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83534-1-RR targets GBP3 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HeLa cells,  Jurkat cells,  HUVEC cells,  U-251 cells\nPositive FC (Intra) detected in: HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGuanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1\/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33889 Product name: Recombinant human GBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 535-595 aa of BC140837 Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI* Predict reactive species\nFull Name: guanylate binding protein 3\nObserved Molecular Weight: 62 kDa, 68 kDa\nGenBank Accession Number: BC140837\nGene Symbol: GBP3\nGene ID (NCBI): 2635\nRRID: AB_3671159\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9H0R5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888370864297,"sku":"83534-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83534-1-rr","provider":"Iright","version":"1.0","type":"link"}