{"product_id":"proteintech-83546-3-rr","title":"Proteintech, 83546-3-RR, MBOAT7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MBOAT7 (83546-3-RR) by Proteintech is a Recombinant antibody targeting MBOAT7 in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83546-3-RR targets MBOAT7 in IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HuH-7 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMBOAT7 (membrane-bound O-acyltransferase domain containing 7), also known as LPIAT, LENG4, or BB1, belongs to the MBOAT superfamily. MBOAT7 acylates lyso-phosphatidylinositol (lyso-PI) with arachidonyl-CoA and is involved in phosphatidylinositol acyl-chain remodeling in the Lands cycle (PMID: 30959108; PMID: 35509994). MBOAT7 deficiency in humans leads to developmental disorders of the central nervous system, with intellectual disability, epilepsy, and autism spectrum disorder (PMID: 37316513). The calculated molecular weight of MBOAT7 is 53 kDa. This antibody can recognize the 45 kDa isoform of MBOAT7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24466 Product name: Recombinant human MBOAT7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 284-344 aa of BC006309 Sequence: SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR Predict reactive species\nFull Name: membrane bound O-acyltransferase domain containing 7\nCalculated Molecular Weight: 472 aa, 53 kDa\nGenBank Accession Number: BC006309\nGene Symbol: MBOAT7\nGene ID (NCBI): 79143\nRRID: AB_3671165\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q96N66\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888861499561,"sku":"83546-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83546-3-rr","provider":"Iright","version":"1.0","type":"link"}