{"product_id":"proteintech-83554-3-rr","title":"Proteintech, 83554-3-RR, TMEM53 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TMEM53 (83554-3-RR) by Proteintech is a Recombinant antibody targeting TMEM53 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83554-3-RR targets TMEM53 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM53 was initially described as a nuclear envelope transmembrane (NET) protein because of its nuclear envelope localization. Research has found that TMEM53 functionality does not rely on viral RNA binding or canonical IFN responses, and TMEM53 exerts an antiviral effect on other bat HKU2-related CoVs in a species-specific manner. Therefore, TMEM53 may be a potential therapeutic target for HKU2-related CoV infections and useful for preparing for future outbreaks of this viral species. (PMID: 37584551)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag21321 Product name: Recombinant human TMEM53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-277 aa of BC064520 Sequence: HFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC Predict reactive species\nFull Name: transmembrane protein 53\nCalculated Molecular Weight: 277 aa, 32 kDa\nGenBank Accession Number: BC064520\nGene Symbol: TMEM53\nGene ID (NCBI): 79639\nRRID: AB_3671171\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q6P2H8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888867299497,"sku":"83554-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83554-3-rr","provider":"Iright","version":"1.0","type":"link"}