{"product_id":"proteintech-83565-1-rr","title":"Proteintech, 83565-1-RR, MRPL51 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MRPL51 (83565-1-RR) by Proteintech is a Recombinant antibody targeting MRPL51 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n83565-1-RR targets MRPL51 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, HEK-293 cells,  SKOV-3 cells\nPositive IHC detected in: human lung cancer tissue, human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial ribosome protein L51 (MRPL51) is a 39S subunit protein of the mitochondrial ribosome. MRPL51 functions in the translation of genetic messages (PMID: 21730110). MRPL51 expression was positively correlated with cell cycle, DNA damage, DNA repair, epithelial-mesenchymal transition, invasion, and proliferation of LUAD cells at the single cell level (PMID: 37323822). The calculated molecular weight of MRPL51 is 15 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7193 Product name: Recombinant human MRPL51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC000191 Sequence: MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR Predict reactive species\nFull Name: mitochondrial ribosomal protein L51\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC000191\nGene Symbol: MRPL51\nGene ID (NCBI): 51258\nRRID: AB_3671180\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q4U2R6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888357691561,"sku":"83565-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83565-1-rr","provider":"Iright","version":"1.0","type":"link"}