{"product_id":"proteintech-83577-1-rr","title":"Proteintech, 83577-1-RR, GAR1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GAR1 (83577-1-RR) by Proteintech is a Recombinant antibody targeting GAR1 in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n83577-1-RR targets GAR1 in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: K562\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGAR1, other named NOLA1, is a subunit of H\/ACA and telomerase. Thought is not required for H\/ACA protein assembly, GAR1 is necessary for ribosome biogenesis and telomere. H\/ACA involves in class specify the sites of uridine-to-pseudouridine. It contains a core domain that flanked by glycine- and arginine-rich(GAR) domains. GAR1 also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transciptase(TERT) holoenzyme.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2282 Product name: Recombinant human GAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC003413 Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH Predict reactive species\nFull Name: GAR1 ribonucleoprotein homolog (yeast)\nCalculated Molecular Weight: 217 aa, 22 kDa\nGenBank Accession Number: BC003413\nGene Symbol: GAR1\nGene ID (NCBI): 54433\nRRID: AB_3671188\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NY12\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888858615977,"sku":"83577-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83577-1-rr","provider":"Iright","version":"1.0","type":"link"}