{"product_id":"proteintech-83608-5-rr","title":"Proteintech, 83608-5-RR, ATM Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ATM (83608-5-RR) by Proteintech is a Recombinant antibody targeting ATM in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n83608-5-RR targets ATM in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A549 cells,  HepG2 cells,  HeLa cells,  Raji cells,  MCF-7 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells,  MCF-7 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and\/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25920 Product name: Recombinant human ATM protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1059-1361 aa of BC137169 Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG Predict reactive species\nFull Name: ataxia telangiectasia mutated\nObserved Molecular Weight: 310-350 kDa\nGenBank Accession Number: BC137169\nGene Symbol: ATM\nGene ID (NCBI): 472\nRRID: AB_3671222\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q13315\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888392851625,"sku":"83608-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83608-5-rr","provider":"Iright","version":"1.0","type":"link"}