{"product_id":"proteintech-83624-1-rr","title":"Proteintech, 83624-1-RR, HDAC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe HDAC1 (83624-1-RR) by Proteintech is a Recombinant antibody targeting HDAC1 in WB, IHC, IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human, mouse samples\n83624-1-RR targets HDAC1 in WB, IHC, IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Jurkat cells,  K-562 cells,  HeLa cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\nPositive ChIP-qPCR detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistone deacetylases(HDAC) are a class of enzymes that remove the acetyl groups from the lysine residues leading to the formation of a condensed and transcriptionally silenced chromatin. The protein encoded by this gene belongs to the histone deacetylase\/acuc\/apha family and is a component of the histone deacetylase complex, which is responsible for gene expression silencing. It also plays an important role in the control of cell proliferation and differentiation by interacting with RB, p53 and other transcription factors. At least 4 classes of HDAC were identified. As a class I HDAC, HDAC 1 was primarily found in the nucleus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0256 Product name: Recombinant human HDAC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-482 aa of BC000301 Sequence: EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA Predict reactive species\nFull Name: histone deacetylase 1\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 58-66 kDa\nGenBank Accession Number: BC000301\nGene Symbol: HDAC1\nGene ID (NCBI): 3065\nRRID: AB_3671237\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13547\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888428961961,"sku":"83624-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83624-1-rr","provider":"Iright","version":"1.0","type":"link"}