{"product_id":"proteintech-83629-1-rr","title":"Proteintech, 83629-1-RR, CTHRC1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CTHRC1 (83629-1-RR) by Proteintech is a Recombinant antibody targeting CTHRC1 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83629-1-RR targets CTHRC1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells\nPositive FC (Intra) detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCollagen triple helix repeat-containing protein 1 (CTHRC1), also known as protein NMTC1, is a glycosylated secreted protein. CTHRC1 was identified as a novel molecular in injured and diseased arteries where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration (PMID: 15618538). It has been reported that CTHRC1 is a positive regulator of osteoblastic bone formation (PMID: 18779865). Besides, studies reveal that CTHRC1 expression is implicated in various malignancies, including hepatocellular carcinoma, gastric carcinoma, colon cancer, and lung cancer (PMID: 23922981; 24504172; 24746208; 25139095).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9812 Product name: Recombinant human CTHRC1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-243 aa of BC014245 Sequence: MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK Predict reactive species\nFull Name: collagen triple helix repeat containing 1\nCalculated Molecular Weight: 243 aa, 26 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC014245\nGene Symbol: CTHRC1\nGene ID (NCBI): 115908\nRRID: AB_3671242\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q96CG8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888608301225,"sku":"83629-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83629-1-rr","provider":"Iright","version":"1.0","type":"link"}