{"product_id":"proteintech-83660-1-rr","title":"Proteintech, 83660-1-RR, SOX4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SOX4 (83660-1-RR) by Proteintech is a Recombinant antibody targeting SOX4 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83660-1-RR targets SOX4 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A431 cells,  MCF-7 cells,  SGC-7901 cells\nPositive FC (Intra) detected in: SH-SY5Y cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSOX4 is a member of the SOX (SRY-related HMG-box) family of transcription factors that play key roles in the regulation of stemness, differentiation, progenitor cell development, and multiple developmental pathways. A single-exon gene encodes the SOX4 protein and contains a highly conserved high-mobility group (HMG) DNA binding domain related to the TCF\/LEF family of transcription factors that play important roles in the Wnt pathway. SOX4 is expressed in stem cells, and modulates stem cell activation and likely also plays a role in stem cell maintenance, possibly through activation of expression of SOX2 (PMID: 23764001, 31445218). The calculated molecular weight of SOX4 is 47 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26583 Product name: Recombinant human SOX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-160 aa of BC072668 Sequence: SQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGG Predict reactive species\nFull Name: SRY (sex determining region Y)-box 4\nCalculated Molecular Weight: 474 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC072668\nGene Symbol: SOX4\nGene ID (NCBI): 6659\nRRID: AB_3671267\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q06945\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888518123689,"sku":"83660-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83660-1-rr","provider":"Iright","version":"1.0","type":"link"}