{"product_id":"proteintech-83709-1-rr","title":"Proteintech, 83709-1-RR, ULBP2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ULBP2 (83709-1-RR) by Proteintech is a Recombinant antibody targeting ULBP2 in WB, IHC, ELISA applications with reactivity to human samples\n83709-1-RR targets ULBP2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Saos-2 cells,  THP-1 cells,  COLO 320 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNKG2D is an activating cell surface receptor that is predominantly expressed on cytotoxic immune cells. NKG2D recognizes a wide range of ligands. In humans, the NKG2D ligand (NKG2DL) includes MICA, MICB, and six members of the ULBP family (ULBP1-6) (PMID: 29568297; 30813924). ULBPs are MHC class I-related molecules (PMID: 11239445). ULBP2 contains two Ig-like domains, the alpha-1 and alpha-2 domains characteristic of the MHC class I family, but lacks the alpha-3 domain. It can be expressed as either a transmembrane or GPI-linked protein, or released from the cell surface (PMID: 21224393; 24614922). ULBP2 binds and activates the NKG2D, mediating the recruitment and activation of NK cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0858 Product name: Recombinant Human ULBP2 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-217 aa of NM_025217.4 Sequence: GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS Predict reactive species\nFull Name: UL16 binding protein 2\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: NM_025217.4\nGene Symbol: ULBP2\nGene ID (NCBI): 80328\nRRID: AB_3671312\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9BZM5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888380137641,"sku":"83709-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83709-1-rr","provider":"Iright","version":"1.0","type":"link"}