{"product_id":"proteintech-83727-7-rr","title":"Proteintech, 83727-7-RR, VEGF-C Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe VEGF-C (83727-7-RR) by Proteintech is a Recombinant antibody targeting VEGF-C in WB, IF\/ICC, ELISA applications with reactivity to human samples\n83727-7-RR targets VEGF-C in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, SW480 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVEGFC is a member of the platelet-derived growth factor \/ vascular endothelial growth factor (PDGF\/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1482 Product name: Recombinant human VEGFC protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 112-227 aa of BC035212 Sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR Predict reactive species\nFull Name: vascular endothelial growth factor C\nCalculated Molecular Weight: 419 aa, 47 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC035212\nGene Symbol: VEGFC\nGene ID (NCBI): 7424\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49767\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888841052329,"sku":"83727-7-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83727-7-rr","provider":"Iright","version":"1.0","type":"link"}