{"product_id":"proteintech-83785-6-rr","title":"Proteintech, 83785-6-RR, ATOX1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ATOX1 (83785-6-RR) by Proteintech is a Recombinant antibody targeting ATOX1 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83785-6-RR targets ATOX1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, A549 cells,  HEK-293 cells,  NCI-H1299 cells,  HepG2 cells,  Jurkat cells\nPositive FC (Intra) detected in: HeLa cells, PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAntioxidant 1 (ATOX1) is a copper chaperone to regulate copper homeostasis in cell. In the cytosol, ATOX1 always binds to copper and transfer to ATPase proteins in the trans-Golgi network, thereby promoting copper supply to various copper-dependent oxidereductases matured within the secretory vesicles (PMID: 28294521). Also, the protein could protect cells against oxidative damage and the expression levels of ATOX1 may help to the inflammatory response and antioxidant defense,even to modulate response to the cancer (PMID: 27472369). ATOX1 plays an important role in the physiology of the human central nervous system ,and it's highly expressed in the cerebral cortex and hippocampus (PMID: 30545441). Either cytosol or nucleus location of ATOX1 has been reported in different literations, which may be associated with cell status (PMID: 24445997; 31317143).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18460 Product name: Recombinant human ATOX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC112248 Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE Predict reactive species\nFull Name: ATX1 antioxidant protein 1 homolog (yeast)\nCalculated Molecular Weight: 68 aa, 8 kDa\nObserved Molecular Weight: 7 kDa\nGenBank Accession Number: BC112248\nGene Symbol: ATOX1\nGene ID (NCBI): 475\nRRID: AB_3671377\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O00244\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888393015465,"sku":"83785-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83785-6-rr","provider":"Iright","version":"1.0","type":"link"}