{"product_id":"proteintech-83808-2-rr","title":"Proteintech, 83808-2-RR, GATA3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GATA3 (83808-2-RR) by Proteintech is a Recombinant antibody targeting GATA3 in IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human samples\n83808-2-RR targets GATA3 in IF\/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: Jurkat cells, U-937 cells\nPositive ChIP-qPCR detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\nCHIP-QPCR: CHIP-QPCR : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression. This is a rabbit polyclonal antibody raised against part of C-terminus of human GATA3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0174 Product name: Recombinant human GATA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-442 aa of BC003070 Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM Predict reactive species\nFull Name: GATA binding protein 3\nCalculated Molecular Weight: 443 aa, 48 kDa\nGenBank Accession Number: BC003070\nGene Symbol: GATA3\nGene ID (NCBI): 2625\nRRID: AB_3671396\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P23771\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888858714281,"sku":"83808-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83808-2-rr","provider":"Iright","version":"1.0","type":"link"}