{"product_id":"proteintech-83815-2-rr","title":"Proteintech, 83815-2-RR, NRAS Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NRAS (83815-2-RR) by Proteintech is a Recombinant antibody targeting NRAS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n83815-2-RR targets NRAS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  HEK-293 cells,  MCF-7 cells,  Jurkat cells,  NIH\/3T3 cells,  C6 cells\nPositive IHC detected in: mouse testis tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP\/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML). NRAS is one member of RAS gene family of oncoproteins, which is commonly mutated in melanoma and hematopoietic cancers via mapped on chromosome 1 (PMID: 2327491, PMID: 26990546). NRAS mediates activation of both mitogen-activated protein kinase (MAPK) and PI3K\/AKT\/MYC signaling (PMID: 17297468). NRAS induced classical MAPK signaling leads to cyclin D1 expression and cell cycle dysregulation and promotion of prosurvival pathways (PMID:7970723,PMID: 18246127). In addition, NRAS effectively prevents Glycogen Synthase Kinase3 (GSK3)-mediated phosphorylation of MYC via PI3K\/AKT, which results in enhanced activity of endogenous MYC protein (PMID: 17297468). Mutational NRAS causes Ras-GTP to be in a state of continuous activation, which results in malignant proliferation and metastasis (PMID: 24985059).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1081 Product name: Recombinant human NRAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC005219 Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM Predict reactive species\nFull Name: neuroblastoma RAS viral (v-ras) oncogene homolog\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC005219\nGene Symbol: NRAS\nGene ID (NCBI): 4893\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01111\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888792817833,"sku":"83815-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83815-2-rr","provider":"Iright","version":"1.0","type":"link"}