{"product_id":"proteintech-83823-5-rr","title":"Proteintech, 83823-5-RR, GADD45GIP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GADD45GIP1 (83823-5-RR) by Proteintech is a Recombinant antibody targeting GADD45GIP1 in WB, IHC, ELISA applications with reactivity to human samples\n83823-5-RR targets GADD45GIP1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, Jurkat cells,  U-251 cells\nPositive IHC detected in: human ovarian  cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGrowth arrest and DNA-damage-inducible proteins-interacting protein 1(GADD45GIP1), also known as CRIF1, is newly identified de novo components in large subunit of mitoribosome. It is essential for the translation of mitochondrial oxidative phosphorylation (OXPHOS) polypeptides in mammalian mitochondria. The essential role of CRIF1 in mitochondrial synthesis and membrane integration of OXPHOS polypeptides was shown in brain-specific CRIF1-deficient mice, which exhibited profound OXPHOS failure and marked neurodegeneration. (PMID 22819524) In addition, GADD45GIP1 enhances the function of GADD45 in maintaining genome stability, DNA repair and cell cycle regulation by interacting with the GADD45 protein family. It's reported that GADD45GIP1 may be induced by p53, a process that is closely related to the cell's response to DNA damage.(PMID:28599472)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9299 Product name: Recombinant human GADD45GIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC013027 Sequence: AASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS Predict reactive species\nFull Name: growth arrest and DNA-damage-inducible, gamma interacting protein 1\nCalculated Molecular Weight: 222 aa, 25 kDa\nObserved Molecular Weight: 25-28 kDa\nGenBank Accession Number: BC013027\nGene Symbol: GADD45GIP1\nGene ID (NCBI): 90480\nRRID: AB_3671407\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8TAE8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888637628585,"sku":"83823-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83823-5-rr","provider":"Iright","version":"1.0","type":"link"}