{"product_id":"proteintech-83829-7-rr","title":"Proteintech, 83829-7-RR, CLCA1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CLCA1 (83829-7-RR) by Proteintech is a Recombinant antibody targeting CLCA1 in WB, ELISA applications with reactivity to human samples\n83829-7-RR targets CLCA1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalcium-activated chloride channel regulator 1(CLCA1) is a secreted protein, and it has an N-terminal zinc-dependent metallohydrolase domain with a conserved HExxE catalytic motif similar to that found in matrix metalloproteases (MMPs), and \"a Disintegrin and metalloproteases\" (ADAMs). The only known substrate for CLCA1 is CLCA1 itself as it undergoes intracellular autocatalytic cleavage resulting in two cleavage products which are both secreted. Since a previous study suggested that a band around 75 kDa, corresponding to the N-terminal autocatalytic cleavage product, was observed in mucus from both human and WT mice. In addition, an additional band at 50 kDa was identified in human and WT mouse mucus, suggesting that CLCA1 can be further processed. However, no band corresponding to the full-length un-cleaved CLCA1 could be detected in the human samples, and only a very faint band was observed in WT mouse mucus, indicating that most of the CLCA1 that is secreted into the mucus is fully cleaved in vivo. (PMID: 29885864)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18176 Product name: Recombinant human CLCA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 715-914 aa of BC156805 Sequence: EINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDYDHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDLFIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILKIMWKWIGELQLSIA Predict reactive species\nFull Name: chloride channel accessory 1\nCalculated Molecular Weight: 914 aa, 100 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC156805\nGene Symbol: CLCA1\nGene ID (NCBI): 1179\nRRID: AB_3671413\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: A8K7I4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888606073001,"sku":"83829-7-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83829-7-rr","provider":"Iright","version":"1.0","type":"link"}