{"product_id":"proteintech-83844-6-rr","title":"Proteintech, 83844-6-RR, SLC31A1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SLC31A1 (83844-6-RR) by Proteintech is a Recombinant antibody targeting SLC31A1 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n83844-6-RR targets SLC31A1 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species\nFull Name: solute carrier family 31 (copper transporters), member 1\nCalculated Molecular Weight: 21 kDa\nGenBank Accession Number: BC013611\nGene Symbol: SLC31A1\nGene ID (NCBI): 1317\nRRID: AB_3671430\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O15431\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888866087081,"sku":"83844-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83844-6-rr","provider":"Iright","version":"1.0","type":"link"}