{"product_id":"proteintech-83846-1-rr","title":"Proteintech, 83846-1-RR, USP53 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe USP53 (83846-1-RR) by Proteintech is a Recombinant antibody targeting USP53 in WB, IHC, ELISA applications with reactivity to human samples\n83846-1-RR targets USP53 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, A431 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: rat liver tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin specific peptidase 53 (USP53) was originally discovered in cholestasis, and its tumor suppressive effects have recently been reported in various cancers. Zhao et al. showed that USP53 interacted with FKBP51 in lung adenocarcinoma cells, and induced apoptosis via the AKT pathway.  Furthermore, USP53 inhibited the progression of clear cell renal cell carcinoma by suppressing the nuclear factor κB (NF‐κB) pathway. (PMID: 35654790)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag28923 Product name: Recombinant human USP53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-600 aa of NM_019050 Sequence: YKSVAENMGCEKPVIHKSDNLKENGFGDQAKQRENQKFPTDNISSSNRSHSHTGVGKGPAKLSHIDQREKIKDISRECALKAIEQKNLLSSQRKDLEKGQRKDLGRHRDLVDEDLSHFQSGSPPAPNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNRGWKPMRETLNVDSIFSES Predict reactive species\nFull Name: ubiquitin specific peptidase 53\nCalculated Molecular Weight: 121 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: NM_019050\nGene Symbol: USP53\nGene ID (NCBI): 54532\nRRID: AB_3671432\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q70EK8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888381022377,"sku":"83846-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83846-1-rr","provider":"Iright","version":"1.0","type":"link"}