{"product_id":"proteintech-83852-3-rr","title":"Proteintech, 83852-3-RR, MYOM3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MYOM3 (83852-3-RR) by Proteintech is a Recombinant antibody targeting MYOM3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n83852-3-RR targets MYOM3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYOM3 (myomesin 3) is a structural component of the M-band in striated muscle and is involved in sarcomere stability and resistance during intense or sustained stretching. MYOM3 can be detected mainly in intermediate-speed fibers of skeletal muscle. Recently high levels of MYOM3 fragments were detected in sera from patients with muscular dystrophy, including Duchenne muscular dystrophy (DMD). MYOM3 fragments may be used as serum biomarkers for DMD and other neuromuscular disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11849 Product name: Recombinant human MYOM3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 888-1213 aa of BC067101 Sequence: SMPTDPVLLEDKPGAHEIEVGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDLGTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNIDILERGEVRLWLEVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVIIQNLSEEDKGSYTAQLQDGKAKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEEASVAPASGLTFSFGCKPGRAKSSGLGVRAGPRLG Predict reactive species\nFull Name: myomesin family, member 3\nCalculated Molecular Weight: 162 kDa, 136 kDa\nObserved Molecular Weight: 162 kDa\nGenBank Accession Number: BC067101\nGene Symbol: MYOM3\nGene ID (NCBI): 127294\nRRID: AB_3671437\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q5VTT5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888436465833,"sku":"83852-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83852-3-rr","provider":"Iright","version":"1.0","type":"link"}