{"product_id":"proteintech-83860-1-rr","title":"Proteintech, 83860-1-RR, FXYD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FXYD2 (83860-1-RR) by Proteintech is a Recombinant antibody targeting FXYD2 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83860-1-RR targets FXYD2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human kidney tissue\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFXYD2 (FXYD domain-containing ion transport regulator 2), also known as the gamma-subunit of the NaK-ATPase, belongs to the FXYD family which has been proposed to be the regulators of Na, K-ATPase function by lowering affinities of the system for potassium and sodium. The expression of FXYD2 is most abundant in kidney, while it is also detected in several other tissues like placenta, pancreas, and dorsal root ganglia (DRGs). Three splice variants of FXYD2 have been reported in mouse kidney, namely FXYD2 γa, -γb,and -γc. FXYD2 γa has been identified as a pancreatic beta cell-specific biomarker. This antibody can recognize all three isoforms of FXYD2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34030 Product name: Recombinant human FXYD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC013289 Sequence: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP* Predict reactive species\nFull Name: FXYD domain containing ion transport regulator 2\nCalculated Molecular Weight: 7 kDa\nObserved Molecular Weight: 7-10 kDa\nGenBank Accession Number: BC013289\nGene Symbol: FXYD2\nGene ID (NCBI): 486\nRRID: AB_3671444\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P54710\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888427094185,"sku":"83860-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83860-1-rr","provider":"Iright","version":"1.0","type":"link"}