{"product_id":"proteintech-83890-5-rr","title":"Proteintech, 83890-5-RR, 4EBP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe 4EBP1 (83890-5-RR) by Proteintech is a Recombinant antibody targeting 4EBP1 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83890-5-RR targets 4EBP1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, K-562 cells,  HL-60 cells,  HepG2 cells,  HeLa cells,  A431 cells\nPositive FC (Intra) detected in: HEK-293 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\n4EBP1 (4E-BP1) is a translational regulator and functions by sequestering eukaryotic translation initiation factor 4E (eIF4E) from the translation initiation machinery. 4E-BP1 contains at least six phosphorylation sites (Thr37, Thr46, Ser65, Thr70, Ser83, and Ser112), four of which (Thr37, Thr46, Ser65, and Thr70) are known to be regulated by mTOR signaling.  Phosphorylation of Thr37 and Thr46 is thought to prime 4E-BP1 for sequential phosphorylation of Ser65 and Thr70, which results in the dissociation of 4E-BP1 from eIF4E. (PMID: 12747827)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5056 Product name: Recombinant human 4EBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species\nFull Name: eukaryotic translation initiation factor 4E binding protein 1\nCalculated Molecular Weight: 118 aa, 12 kDa\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC004459\nGene Symbol: EIF4EBP1\nGene ID (NCBI): 1978\nRRID: AB_3671473\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q13541\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888381776041,"sku":"83890-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83890-5-rr","provider":"Iright","version":"1.0","type":"link"}