{"product_id":"proteintech-83892-3-rr","title":"Proteintech, 83892-3-RR, PHF19 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PHF19 (83892-3-RR) by Proteintech is a Recombinant antibody targeting PHF19 in WB, FC (Intra), ELISA applications with reactivity to human samples\n83892-3-RR targets PHF19 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HeLa cells,  HEK-293T cells,  NCCIT cells,  U-251 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHD FINGER PROTEIN 19(PHF19), a protein homologous to the Drosophila 'Polycomblike' (Pcl) protein, encoded by human gene PCL, which encodes 2 deduced proteins: a short form of 207 aa and a long form of 580 aa. The PCL family proteins contains a PCL homology domain, a Tudor domain, 2 PHD fingers and a C-terminal tail. It is highly expressed in thymus and heart, while 508aa form predominant in placenta, skeletal muscle and kidney and 207aa form in liver and peripheral blood leukocytes. Both of these forms can inhibit transcriptional activity. And the long form is corelated with cancer.Acts as a transcritpional repressor. The mRNA level of PHF19 is low in many normal tissue, it's elevated in cancer-derived cell lines.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2511 Product name: Recombinant human PHF19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC022374 Sequence: MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL Predict reactive species\nFull Name: PHD finger protein 19\nCalculated Molecular Weight: 580 aa, 63 kDa\nObserved Molecular Weight: 62-66 kDa\nGenBank Accession Number: BC022374\nGene Symbol: PHF19\nGene ID (NCBI): 26147\nRRID: AB_3671475\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q5T6S3-2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888438890665,"sku":"83892-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83892-3-rr","provider":"Iright","version":"1.0","type":"link"}