{"product_id":"proteintech-83908-3-rr","title":"Proteintech, 83908-3-RR, B7-H6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe B7-H6 (83908-3-RR) by Proteintech is a Recombinant antibody targeting B7-H6 in WB, ELISA applications with reactivity to human samples\n83908-3-RR targets B7-H6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  K-562 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB7-H6, also known as NCR3LG1, is a member of the B7 family of immunoreceptors. It is a 454-aa-long type I transmembrane protein consisting of an extracellular region, a transmembrane segment, and a cytoplasmic domain which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM), an SH2-binding domain, and an SH3-binding motif. B7-H6 triggers NKp30-mediated activation of human NK cells (PMID: 19528259). It has been reported that B7H6 is expressed in various types of tumor cells and plays a prominent role in natural killer cell immunosurveillance (PMID: 35697295). The apparent molecular weight of B7-H6 is larger than the calculated molecular weight of 51 kDa due to glycosylation (PMID: 19528259).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0007 Product name: Recombinant Human B7-H6 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 25-262 aa of BC136800 Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS Predict reactive species\nFull Name: hypothetical protein DKFZp686O24166\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 75-80 kDa\nGenBank Accession Number: BC136800\nGene Symbol: B7H6\nGene ID (NCBI): 374383\nRRID: AB_3671488\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q68D85\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888590508201,"sku":"83908-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83908-3-rr","provider":"Iright","version":"1.0","type":"link"}