{"product_id":"proteintech-83931-1-rr","title":"Proteintech, 83931-1-RR, CLSTN3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CLSTN3 (83931-1-RR) by Proteintech is a Recombinant antibody targeting CLSTN3 in WB, ELISA applications with reactivity to human, rat samples\n83931-1-RR targets CLSTN3 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalsyntenins, also called alcadeins, are cadherin superfamily proteins first identified as synaptic proteins (PMID: 11161476; 12498782). Calsyntenins are type I transmembrane proteins with extracellular domains containing two cadherin repeats and an LNS (laminin, neurexin, sex hormone-binding globulin) domain (PMID: 24613359). Calsyntenin-3 (CLSTN3, also known as alcadein-beta) is a synapse-organizing protein that promotes the development of synapses. It is a postsynaptic adhesion molecule that binds to presynaptic neurexins to mediate both excitatory and inhibitory synapse formation (PMID: 25352602; 24613359).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag14897 Product name: Recombinant human CLSTN3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-289 aa of BC039075 Sequence: VLGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDDSALTIIVNPMEVRGLGKRGSVGSRLWSTHVLPESAVLCDGGCWGPAGG Predict reactive species\nFull Name: calsyntenin 3\nCalculated Molecular Weight: 968 aa, 107 kDa\nObserved Molecular Weight: 130 kDa, 140 kDa\nGenBank Accession Number: BC039075\nGene Symbol: CLSTN3\nGene ID (NCBI): 9746\nRRID: AB_3671512\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9BQT9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888606597289,"sku":"83931-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83931-1-rr","provider":"Iright","version":"1.0","type":"link"}