{"product_id":"proteintech-83934-2-rr","title":"Proteintech, 83934-2-RR, NEU2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NEU2 (83934-2-RR) by Proteintech is a Recombinant antibody targeting NEU2 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples\n83934-2-RR targets NEU2 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: PC-12 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEU2, also named as Sialidase 2, neuraminidase 2,  catalyzes the hydrolytic cleavage of the terminal sialic acid (N-acetylneuraminic acid, Neu5Ac) of a glycan moiety in the catabolism of glycolipids, glycoproteins and oligosaccharides. NEU2 is localized in the cytosol and plasma membrane and takes part in myoblast and neuronal differentiation. It is almost undetectable under normal physiological conditions, and was found to be involved into apoptotic events in pancreatic ductal adenocarcinoma, one of the most dangerous cancers due to poor diagnosis and prognosis. (PMID: 30439363)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag17386 Product name: Recombinant human NEU2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 66-380 aa of BC107053 Sequence: VQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAFPAEYLPQ Predict reactive species\nFull Name: sialidase 2 (cytosolic sialidase)\nCalculated Molecular Weight: 380 aa, 42 kDa\nGenBank Accession Number: BC107053\nGene Symbol: NEU2\nGene ID (NCBI): 4759\nRRID: AB_3671516\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9Y3R4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888862613673,"sku":"83934-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-83934-2-rr","provider":"Iright","version":"1.0","type":"link"}