{"product_id":"proteintech-84020-3-rr","title":"Proteintech, 84020-3-RR, FOXF1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FOXF1 (84020-3-RR) by Proteintech is a Recombinant antibody targeting FOXF1 in IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84020-3-RR targets FOXF1 in IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFOXF1 (Forkhead box protein F1), also known as FKHL5, It is expected to be located in the nucleus, which is expressed predominantly in lung and placenta. FOXF1, a member of the Forkhead box family of transcription factors, as one of the most highly and consistently upregulated genes in FP-RMS. While it is known that FOXF1 is required for mesodermal differentiation toward endothelial and smooth muscle cell lineages, FOXF1 is not expressed in differentiated skeletal muscle cells, and its role in fusion-positive FP-RMS remains unknown (PMID: 33627785). The molecular weight of FOXF1 is 40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34266 Product name: Recombinant human FOXF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-379 aa of NP_001442 Sequence: MYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCVM Predict reactive species\nFull Name: forkhead box F1\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NP_001442\nGene Symbol: FOXF1\nGene ID (NCBI): 2294\nRRID: AB_3671589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q12946\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888858386601,"sku":"84020-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84020-3-rr","provider":"Iright","version":"1.0","type":"link"}