{"product_id":"proteintech-84068-4-rr","title":"Proteintech, 84068-4-RR, CRTAM\/CD355 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CRTAM\/CD355 (84068-4-RR) by Proteintech is a Recombinant antibody targeting CRTAM\/CD355 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n84068-4-RR targets CRTAM\/CD355 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  mouse brain tissue,  rat brain tissue,  mouse spleen tissue,  mouse cerebellum tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytotoxic and regulatory T cell molecule (CRTAM, also known as CD355) is an immunoglobulin-superfamily transmembrane protein with V and C1-like Ig domains, which is involved in epithelial cell adhesion (PMID: 18329370; 20556794). CRTAM is critical to instruct the differentiation of CD4+ cytotoxic T cells (CTL) through the induction of eomesodermin and CTL-related genes (PMID: 26694968). It also regulates CD8+ T cell retention within the lymph node and eventually effector function (PMID: 19752223). The predicted molecular weight of CRTAM is 43 kDa. Due to glycosylation, the observed molecular weight of CRTAM can be apparent at ~80 kDa (PMID: 16300832).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1541 Product name: Recombinant Human CRTAM protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 18-286 aa of NM_019604.4 Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS Predict reactive species\nFull Name: cytotoxic and regulatory T cell molecule\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_019604.4\nGene Symbol: CRTAM\nGene ID (NCBI): 56253\nRRID: AB_3671636\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O95727-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888353398953,"sku":"84068-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84068-4-rr","provider":"Iright","version":"1.0","type":"link"}