{"product_id":"proteintech-84077-6-rr","title":"Proteintech, 84077-6-RR, FKBP2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FKBP2 (84077-6-RR) by Proteintech is a Recombinant antibody targeting FKBP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n84077-6-RR targets FKBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  K-562 cells,  HuH-7 cells,  NIH\/3T3 cells,  mouse cerebellum tissue,  rat brain tissue\nPositive IHC detected in: human placenta tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFKBP2 is also named as FKBP13 and belongs to the FKBP-type PPIase family. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP2 has a 21-amino acid signal peptide and appears to be membrane-associated(PMID:1713687). It is localized to the lumen of the endoplasmic reticulum (ER). FKBP12 and FKBP13 are highly similar proteins, of molecular masses 12 kDa and 13 kDa respectively, with approx.43 % amino acid identity. The strong homology between FKBP12 and FKBP13 suggests that they may share similar biological functions, although, apart from rotamase activity, details relating to the function of either protein are scant (PMID:8373365).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2255 Product name: Recombinant human FKBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC003384 Sequence: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL Predict reactive species\nFull Name: FK506 binding protein 2, 13kDa\nCalculated Molecular Weight: 142 aa, 16 kDa\nObserved Molecular Weight: 13-16 kDa\nGenBank Accession Number: BC003384\nGene Symbol: FKBP2\nGene ID (NCBI): 2286\nRRID: AB_3671646\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P26885\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888637071529,"sku":"84077-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84077-6-rr","provider":"Iright","version":"1.0","type":"link"}