{"product_id":"proteintech-84083-2-rr","title":"Proteintech, 84083-2-RR, VGLUT2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe VGLUT2 (84083-2-RR) by Proteintech is a Recombinant antibody targeting VGLUT2 in WB, IHC, IF-Fro, ELISA applications with reactivity to human, mouse samples\n84083-2-RR targets VGLUT2 in WB, IHC, IF-Fro, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVGLUT2, also known as SLC17A6, belongs to the major facilitator superfamily. VGLUT2 is a multifunctional transporter that transports phosphate at the plasma membrane and glutamate in synaptic vesicles (PMID:33440152, 11432869). VGLUT2 is involved in neurotransmitter loading into synaptic vesicles (PMID: 11698620). VGLUT2 is predominantly expressed in adult and fetal brain, with highest expression in the medulla, substantia nigra, subthalamic nucleus, and thalamus, and low levels in the cerebellum and hippocampus (PMID:10820226).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29565 Product name: Recombinant human SLC17A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-582 aa of NM_020346 Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS Predict reactive species\nFull Name: solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_020346\nGene Symbol: VGLUT2\nGene ID (NCBI): 57084\nRRID: AB_3671651\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P2U8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888523071657,"sku":"84083-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-84083-2-rr","provider":"Iright","version":"1.0","type":"link"}